TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3UAU5|A3UAU5_CROAH Uncharacterized protein OS=Croceibacter atlanticus (strain ATCC BAA-628 / HTCC2559 / KCTC 12090) GN=CA2559_12863 PE=4 SV=1
MKLYTSFLFLLLYTVASSQIIGKVTDARSEPLPFVNIYIDNSSTGTTTNKDGNYELNIDALGTYTISFQFIGYTPEKKTV
QVSKLPYILNATLQEETTSLDEVVLNSGENPAYRIIREAIANRKTNLAKTNEFTADFYSRGLWRIEDAPEKILGQEIGDF
NGGLDSTRQGVIYLSETISEIKYKAPDNFKENIVASIVSGDDNGFSLNTAQESNISFYNNTINLNTQVISPIADYAFNYY
DYKLVGVFYDDLGHLINKIEVIPKRQNDPVFSGLIYISEDTYEIYGTALNITGKAIQIPFIETLVFTQNFKYSTIDSLWL
RTSQVVDFSFAFFGVKGNGRFTAVYSNYDFSPQFDSKTFGSEILTYESEANKKDSIFWKGVRPVPLTDEELTDYIKKDSI
QEIRGSKTYLDSVDRAENRFKVSDVLFGYHYKNSFKKYDFDISAPITNIHYNTVQGWNGSLTASFQKNQEEFNRKYWRLY
TTGNYGTSDEKLRLKAGYQQKFNNTSRPILSLEAGTETQQINSEEPIKLIVNDVASLFFERNYLKTYERQYAQIGYSQEL
INGLRFYGGASYERRIPLFNTTDQTFYPREDEQFTSNNPLQPLNEDSAPFVEHNIVKASLNAQLVFGQKYYSYPDGKYNT
RPDKYPVLFLGYEGGYGATVSDYNFHHLKARLAQAFNIGNKGRFGYNLRTGTFLNGEAISYLDFKHFNGNQTRIGTSNTY
LNNFNLLPYYALSTNDTYFEGHLEHDFKGYILNKIPLVNTLGFSLVLGAHTLNTTQNKPYTEYSVGFDNVGFGKFRFFRV
DYVTSNINGNKESAFIFGLKVLNLLGID