TCDB is operated by the Saier Lab Bioinformatics Group
>A4I3X2|A4I3X2_LEIIN Putative uncharacterized protein - Leishmania infantum.
MTPLAPSSFKGQLLLALMLSIGLKVLTFSLSTILTRLLLPYQNGVYFTFNVYNDAVLFIAREATRNVASRLPIIEPSAEA
EDSAEQDGKGGAAHEMSPAERGRAPSAPSASSTRTPASLVSVANVRAVVSIAFCSVPLAIVVAAVVEALGTCLGAASFFP
SMMQHARASQQVFRKAENASGLDGASTLTGLPFLLLPYMPETTVVLCAVLMAAVEPCVVLVQSLNLFRVVVLAECATLVA
RLCTIIGIVYACQRNSAGGRTPQGEVGNGLRTMWEARMALAFGQLAYAITHVIYYSLVLSGLPVARWLGSSTAMEQVRAA
ALLAHARDMGHSEQDIGPGRSAGDAKAAPSSALAAPLQAGRWATFAFPFCFYSIVDSVAVCRRYASLFSTFLRESLLRLV
LSEGESLTLTSLGSETARGYYQLISSLGSLVARLLFRIWENACFVKWSREASLGHRHTAVQLLKLMLRLAFYVSFSFTLL
GPPLAKTFLATMYTSRWATPQVSTALQLYFYDLPLMAWNGLLEAFLRAVASPAVLQRLQRWMVGETVLYIAACYVTLVAF
GKADSQGESVSVLVLLNIFNTLWRCGVSIYLLVSSPGAAVGSATAASTDAQAKDGGGPAAPAAPSLAPPSPIVHLRDFAS
LFPKHIVGSILGIFVCSRVLRAYSVVTIAAVGLAYAAVILAWDGEVRQLLVTPVWSRVRPLLLGSHEGSHVGLATAPPRS
VELPKSMAA