TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4QA60|A4QA60_CORGB Uncharacterized protein OS=Corynebacterium glutamicum (strain R) OX=340322 GN=cgR_0143 PE=4 SV=1
MTHPVNNTPTATDTTAGTTPTIGSRPQERVHPTWPLYLLFFTVAGAIGGTVAYSFLGESLAALGIPNPGIATTFGLPFFR
AVGWMLAALSAGSFLFAAFLISPRLPGGDHDRLHQASLSVDGHLASRTGAVAAICFGLIALLMIPLVLSDVSGTPLAQTL
GLETLTVAVEQVAMAQVWLIVALIALVTGGTGLMSRAWITQPLLLLGSILMIIPLGLTGHSSSGGNHDHGTNSYLWHLVF
LVLWVGGLMALLAHGRRLGPDLDIALRRYSTIALVSIIVMAVSGLVNAAIRIELTDLLTTRYGLIIVAKTIGVIILGVFG
WIHRAWVIPQVQANPADRRLFRQVAIVEVLVMAAVTGIAITMGRTPPPPPRIPNLSQMATKLGYELSEKPTILNVWGMWR
FDLLFGALALLLAVGYLSAVWRTRQTGHTWSSTPTAWWLAGCVTLLVTMSSGIGLNMPAVFSVHMVGHIILSLVIPIFLV
MGAPLTLLMTAFAPGAPGRPNIHDWVRAFTRSRLVGVITHPVVNTLQFLVFFYVMYLFIPLYELLISKYAGQLIMNTVLL
VSGSIYFWGLMEPDPVPHRRPAPVRLAWLLASLPVHVGFGVYLSQLTTVMGEEFYRSLLLPWDIDLLADQHAAVTAWAIG
GIPLLLAIILLIRQWRDIRRRPHDQAPLAVPAE