TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4V408|A4V408_DROME ER GDP-fucose transporter, isoform B OS=Drosophila melanogaster GN=Efr PE=4 SV=1
MALNLKALLGMLFVFIGCCSNVVFLELIIQIDPGAGNLITFAQFLFIALEGLVFTSKFFTVRPKIALKDYVILVALFFGA
NVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNLRQYSSVAMITAGIILCTLVSSGDVKDNTHHSLKVDTSY
SDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKHPSEALFFTHMLPLPGFLIMAGNIVQHFGIAWSSEPVAVPLLGA
IGLEWKFPLMLFYLLCNVVTQYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNHWVGTILVFFGTIL
FANVINQVRDAYRARSSRKTHFDTAPLAKKVE