TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5A9P9|A5A9P9_MYCCH Membrane protein OS=Mycobacterium chelonae GN=mmpl4a PE=4 SV=1
MSESDGKGQSHRPIMATIIRKGAVFIILGWLAITVLLTVKVPPLEIVEREHSVSLSPPDAPSVKAMTQMGKVFQESNSES
VAVIVLEGENPLGDDAHKYYDAVVRQLKDDPKHVQHIQDFWGDPLTAGAAQSADGKAAYVQLNLTGRFGQADANESVEAV
QKIVKDTPGLPPGVKTYVTGPAAVVSDMSESGNRTVILITLVSVGVIFLMLLLLYRSFITVIILLFTVGIELQVARGLVA
FLGMHGIVGLTTFVVNLLVSVGIAAGTDYGIFFTGRYQEARQAGEDRQTAYYTAYRGVAKVVLASGLTIAGAIACLHFTR
LPYFKPLGIPGAVGILVAVAVALTLVPACIAAGSRFGLFDPKRQVTTRRWRRLGTAIVRWPGPILAGTVAISLIGLLTLP
GYNPSYTDAKYIPKDIPAVQGLVAASRHFPESKMSTPDILLVEANHDMRNSADLLVLNRLAKAVFAVPGIANVQSITRPE
GTQIEHSSVPFMLSMSNASQRLSLPFQRARMDDMLKQADDMGTTIALMQRMFDLMKQMVATTHRMVSTTHDLQKDMSTLR
DHIENFEDFWRPIRNYFYWEKHCFDIPICWSIRSIFDALDGVDQVTDKMQTLVGDLDELDRLMPQLLEQFPIMIDTMKST
RESMLTMHSTMSGIFAQMDESTENSTAMGKAFDASKNDDSFYLPPDVLNNKDFKRVMKIFMSPDGKSTRMLISQRGDPAT
PEGIARVDPIKTAAEEALKGTPLEHAKISLAGTAAGVSELVDGSKYDLLIAGVAALCLIFIIMLLMTRSLVAALVIVGTV
ALSLGASFGLSVLVWQHICGIQINWVVLAMSVIVLLAVGSDYNLLLVSRMKEELGAGLNTGIIRAMGGTGKVVTAAGLVF
AATMGSMIVSDLLTLGQVGTTIGLGLLFDTLIVRAFMTPAIAALLGRWFWWPLQVSPRPVGAVHGWKGPRLVRSVLQRN