TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5FBZ0|A5FBZ0_FLAJ1 Uncharacterized protein OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=Fjoh_4275 PE=4 SV=1
MKNTFFLLLLLGIFFYANAQQKPVFQKLRYEDDFTYLKADSTKTPYEKIKYIPLGKNDKYYASIGGEARLQYTYTVNNKW
GDESDDDGYLLSRYLLHANVQLGVFRTFFQLQSSLANGKTDPSPVDENQLDIHQAFLDIDFIRKENEQLTLRFGRQEMSY
GSQRLVAVREGPNSRLAFDGLKLFYKKNNWQSDAFFTHPIANKQGTFNDSFNENAKFWGSYTVIHKVPFIQNIDLYYLGL
WKSRAVFDDAVGAENRQSIGTRIWKNKGNWKYDFEGVYQFGNINQRTISAWTISSFACYTFENIKYTPEIGLKTEIISGD
KNSGDGYLQTFNPLYPRGAYFGLVALIGPSNLVDVHPSINFSLSEKWGLGIDYDIFWRQTISDGIYAPNMQLLYSGKDTT
ERFIGSQLISNVNYDMNNHLGFTLETGWFNAGSFLKEVGSGKDYFYAALTAQFKF