TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5IFT5|A5IFT5_LEGPC Transmembrane protein OS=Legionella pneumophila (strain Corby) GN=LPC_2312 PE=4 SV=1
MGSGVFIILSAILHAAWNTFAKRNSTPYYEVLGIMSFATIFSLVFIPFFSGPLFETSDSFLWALTSGLFEGGYIITLAIS
LSQSSLGKAYIIMRGSAMVIVWFISACFLGENINLFNIIGISSVFSGLILTSQTFNSDQSRQLFFPVLCGICIAGYHLCY
GRSLAYGANPAALFSAALWIALPCVFLLMKKKQRRVFKEQVKSNWKITSLGGIISALSFLLFLIGLRHSEAGLALTLRNT
SVVFAQIFAYFIGEKISRYQWIGAFLVALGASLIYPY