TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5PGX0|A5PGX0_CORDI Porin protein A OS=Corynebacterium diphtheriae GN=porA PE=4 SV=1
MQNIENWVALSTDENSIVTVIFDLLKQVAKMGKAIADLIGLAK