TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5UL63|A5UL63_METS3 Conserved hypothetical membrane protein Msm_0736 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=Msm_0736 PE=4 SV=1
MIDIFNMVFEALNAIFSPLLALDPNPQNPALTVLVIAFIVSLITTIANKLLVDQDEMNEIQQKMKDYQKEVREAQKSGDG
KKLAKLQAQQAEIMQNQSKMMTNSFKPMIVTFIPIILIFFWMRASPISGLVISMPPGAFYVSLAPIWHFIGSFMYGGHSV
GYNIGWLFWYFICTFGMSQILRKFLGFKQGF