TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5UXW1|A5UXW1_ROSS1 Cobalt transport protein OS=Roseiflexus sp. (strain RS-1) GN=RoseRS_3101 PE=4 SV=1
MFQRLWLASVAQPLHPLLSVACAAVALTFGLLLRDATTLLTFVAGLGLIFMMVGYGVLLARIARIVIPLAALIGVLAALF
GGGVSGGLMTFGRISLLGLTIAFAWTIDPTQLARALRQAGAPPLVALSLLITVRSIPTLVGEAVRIRDAMRVRGLSLRHT
PLRILYRALVVPLLIRVLTLSESLALALETRAFTGDPCATIYRPVALHGRDYATLALMVILMSGVAGAQWLFN