TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5UXW2|A5UXW2_ROSS1 Putative uncharacterized protein OS=Roseiflexus sp. (strain RS-1) GN=RoseRS_3102 PE=4 SV=1
MIARLTLRDVVFLAVVAACLLAVSFLVVPLVISLPIPGIRSLAPSPFYGLLLAVALLKVRQPGTLFVVVSLVGLVLLMMA
WVMFAINVIAGALAELIVLAVFRSYQRNEAVLLAAGLYMPLTVLVGLGIGAVVGGPTIARFLMNPWLIVPVLGATALLSF
IGAWAGLRLGQELRVAGVLRA