TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5ZGZ4|A5ZGZ4_9BACE TonB-dependent receptor OS=Bacteroides caccae ATCC 43185 GN=BACCAC_02166 PE=3 SV=1
MKRLLTLLLFFNTMLLLLQAQPMHQIKGTVIDKNSRQPLEFINVMIIGLNKGSVTNAEGRFTIEQVPPGIYRLQASAIGY
KSVTTSEYILSTKNLNIPIEMEENLTELEGVTITASPFRRDVESPVSLRIIGIQEIEKSPGANRDISRIVQSYPGVAFSP
IGYRNDLIVRGGAPSENRFYLDGVEIPNINHFSTQGASGGPVGILNADLIREVNFYTGAFPADKGNALSSVLDFKLRDGD
MERNSLKATLGASEVSLASNGHIGKKTSYLVSVRQSYLQFLFDMLDLPFLPTFTDAQFKLKTRFNEQNELTVLGLGGIDN
MRLNTKADSEDNEYILSYLPKIKQETFTVGAVYRHYAGAHVQSAVVSHSYLNNRNTKYRRNDESHPDNLMLRLRSTEQET
KLRLENSTTFRNWKINLGVNLDYSQYTNTTFQRVYTNQPQTFDYHTYLGILRWGLFGTINYTSMDDRFTASLGLRADASD
YSSTMKNLSDQLSPRLSLSYQLADHWFASGNAGLYYQLPAYTALGFKNNNGTFANKYNLRYMKVSEGSLGISWRKGDTFE
ASVEGFYKDYDKIPLSVADGIPLNCKGNDYGVVGNELLTSTAQGRSYGAEILVKWLIAKKLNLASSFTLFKSEYRNDKES
EYIASAWDNRYIFNLRGTYNLPHQWSFGMKVSCIGGAPYTPYDETKSSLVSAWDAQGKAYYDYSKYNKERLPAFAQVDVR
VDKTFYLKHCMLGFYLDLQNITVSKLKQQDVLMSTGIIENPEAPAAAQRYRMKRIKQSSGTLLPTLGITFEY