TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6DS17|A6DS17_9BACT Uncharacterized protein OS=Lentisphaera araneosa HTCC2155 GN=LNTAR_08216 PE=4 SV=1
MKSKTKVGLFLATLLSLSLSAHDSSAHEHNDHKLGDQLKADADLKSGSQEHEHDSKLASFIGVEEYISLSGTIGLYGQTM
DANDDNIDRDELAAIYGALHLETREWQGFRLGLTALAHGELHDHNDNYNEYYDNNAALLAEAFLKYNYKETEFTLGRQGV
DWLMLGDYFEGVFVESEAIEDFLIRAAWVHKGAVFDPDEMFDYDELNDDDGVFGTEITYNGIEGLAITGLYYQAPDAYDI
YGGEVFHEYAFCDKWSNAFLVQYFETDEKSSFADYPSI