TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6LQ39|A6LQ39_CLOB8 Uncharacterized protein OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=Cbei_0281 PE=4 SV=1
MKNELKMEFSRCLNSKKFKYCFSILFGLTILSYAMLFKQTFQRNSLQLGKTTDYSMIISSSDIRTIFLTFVLIAPLICTL
MYSDSFIEQRENNMYSIFLMRSGKKRYIIAKTITIFTVTFVSIFFILGFNEILTWISIPDVGINNGQPAYLIIQNNKAEY
FLQDIYDRFPHLYNFIIIIITALFCSISSLIAFNLSMIFKINKIIMVIITFLIVNGTEMFLSDDYQMQMYIQTWPAEFKK
FLMVLSIWILLTVITFVIGIKKEII