TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6Q1E2|A6Q1E2_NITSB Putative uncharacterized protein OS=Nitratiruptor sp. (strain SB155-2) GN=NIS_0187 PE=4 SV=1
MRNKILLSFFAASLLYGNDTCYSVQLLSSNKPFNYKSSFPQGAKIMHINRTYTLRYGCFDQVRDAKPALRRLKRQFPQAY
IVSTYRYRFKDGNSHTKSLQTFKKDLYFQPANTKKKHPSSLQKEESNIEEEIIPSPPIKTIVTQDATPQVSAPKQSIQKV
RKKSCFTIDLIESQNPIDNANLPLGTKIIQKYGMYIAQYGCFDTVTQAKPTWQRLKKEFPEAIIIPTTQEIVEETTEKLG
PIHKRFQTIHTLSPLQQKPKSSLPKPSFYKKVPTAHTKQSNCSSETEKNIVACRDKCIENKKNYPWENIDLDAVESYVNA
LVEQRIPKLTIPKSSTRSLSHILIGNEENTTYPTPQEKLNFYTTASLNINYGQTDTNGTRLDNQSLTVTAGLKYKYYFLP
LWYFFTDDRALLYLSKSKAETKFDVKELYISSDGLFDNQANFLIGRKYLKDKRAWYYKTSLDSVGIFNKHDLLLYELYGG
TRLTDSIVFNTGEDESLVNLKDTKFLIGHLSYEYLKDNTIEGFYIHEDGNLKNADWVGIRMQGKIERFNQDKISYWADVA
HANGSYKRLRTITTFPPITIQENKKIQGLGFDIGGKYTFTRYNSAIAASVAYGSGGGNLYRQPSLTNNRSNYLSKDISFR
RYGSFFNPELSNMWISSVYFVHHLWGDQNKTAIAALHNYMQDKASSTQYFASPYTYAPNGKKKNLGSEIDLILHYDLFDD
TYWRFVLGYFFGGEAFNNKASKKDGLNAQIYFKYLW