TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6T6J1|A6T6J1_KLEP7 Multidrug efflux pump accessory protein AcrZ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ybhT PE=3 SV=1
MLELLKSLVFAVIMVPVVMAVILGLIYGLGEVFNLFSGVGHKDRSQQNH