TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6THI4|A6THI4_KLEP7 Putative transmembrane protein, transport OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=yjgQ PE=4 SV=1
MQAFGVLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLKKSGQGSYDALGAGLYTILSVPKDIQIFFPMAALLGALLGL
GMLAQRSELVVMQASGFTRLQVALAVMKTAIPLVLLTMAIGEWVAPQGEQMARNYRAQQMYGGSLLSTQQGLWAKDGHNF
VYIERVKGNDELGGVSIYAFNPERRLQSVRYAASAKFDSENKVWRLSQVDESDLTDPKQVTGSQMVSGTWKTNLTPDKLG
VVALDPDALSISGLHNYVKYLKSSGQDPGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFIFY
VLDQIFGPLTLVYGIPPIIGALLPSASFFLISLWLMMRKA