TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7MNN3|A7MNN3_CROS8 Putative uncharacterized protein OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ESA_02748 PE=4 SV=1
MSKLASGAAYGASAGTVANGLLTRLSPDEWSAVGVIAGIVVALLTFGINWYYKRKTTLAQIQAYERWPSAAGQLSKED