TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7NH44|A7NH44_ROSCS NMT1/THI5 like domain protein OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=Rcas_0667 PE=4 SV=1
MKRTFIVALAAFILAACGGAVPSAPVKELASVRVGLDWTPNTNHTGLYVARDKGYYQEQGLDVEILGAQEGGAVEQLVAT
GKLDFGISFQEAVTYARVEGVPVVSIAAIIQHNTSGFASRADEGITRPRDFAGKKYGAFGSPIEQATIKGLMECDGAGDR
FDQVEFVDIGSTDFFVATDRGDVDFAWIFKGWTGVEAEVRGVPLTILMMNDLRCIPDYYTPVLITSEQMIAEKPDLVRRF
LAATSAGYRFAIEKPDEAADLLLKAAPELDATLVKRSQQYLASQYQAEAPRWGEQKLDVWRDYAQWMTDHGLIARMIEPE
KAFTNEFLP