TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7NRG1|A7NRG1_ROSCS Cobalt transport protein OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=Rcas_4125 PE=4 SV=1
MASRFDPRAKALSYLIGSAAIILSTDLIRLAFLSGGLALLLIGIGLGRRWLQVMKALTPTLMLFALVAGWSGGFDAAIGA
ALRLTALVGAGVLFFGVTPPEELGDALLASGVPSQIAFLLEGALRFTPMMGTLAREVYEAQASRGIRFDGRHLLRNGPLL
LTPLLLSVMRFADDLAEGLETRGFGSPQRTPLRDYRLGWRDGALIGVALLLTILIVW