TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8E1J7|A8E1J7_MUHVK M78 protein OS=Murid herpesvirus 1 (strain K181) GN=M78 PE=4 SV=1
MPTSSCAVDYSYPEVDAEHLSFIQTYNILVTSTFAVVGLISIVLILGSLILSMWRKVWHRRNGGARIYVFSLFLAEFMYV
ASFVAIWLVRVVCPSKVTEPYCRLAIMVNGMSEGAVSFFYLYLTLDRLCLVGAVTEKKTIFNTSAGKDLVGVIWVTVVAW
ISAFIVGAPALTSQVMRDRAGFLPVCEMQGPDDMPYVLMHVTAVYVVPFLIIISRLFEMRYSARDGTWHFVSGASIYYVM
YMIIVVPIIICRVVISFGEIGHSLSQTTLQYVDLISTAGWQGRGIAVAFACDVVVKYVEAAGELHASVDGSDDRRSLCAD
LPSCIYPVGTTLVKSTFGFFLKGAKTMLRLCRRVSPFGIQKDALKSPAAMKALEGAAYDNKSFSPDEDDDDKIPTVCEKT
GPPPSLTEIAMTPVVDSQQKMTSLPMSVFYSDGGEKEGVQGDEGGHIIPIPPSDGVTDDVSALLPTSSSVV