TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8INK8|A8INK8_CHLRE Predicted protein (Fragment) OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_144974 PE=4 SV=1
MTEFATCHLSFRTFTFISAYSVIAQLRPNDAATHTALFLICRRVPYLLLFPVTGLAADRLNRGALLVAVCLVEGAVSFTL
PLVQQQQNIWLLYPLIFCQYCAQAFYDPARTATLPSVVPRPLLHVAGTLDFLGYSLMALTAASAAGRTAAVYGPILCFRV
EGVAFGLAALLLMRLALHGAGTKKPGGRQHPRSRAVNSSGAGPGGSTGSKGAGSWDAEPPPELQPLLEEGEADVEILGLA
AGRRVESASLGLLEEVEEPAGCGGCGALAYLSQRQNWDVAMTVWVKATGAMVWGAADVLNGRFSAQSCMQSLGGPDQTLG
FILAAVGVGCVVGPLFVNSITPGVARCWRISIAAAFGLLAAGYAVMAAASSIMWILPASSIRTAGSTIIYIHSFAILQHR
LHEGIRGRVFAVEFVLFTISEASSSLAAGWALDGLGWSTHRLSATIACVATGFM