TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8IVT4|A8IVT4_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_172465 PE=4 SV=1
MEVKLALISAALAALVTAVIMPYTDPENLAKLSQHPVAGLVLNTTADAFYAFGTWVGGGDGDDPAAGGPSLRDYYPLTLP
PRDPAAATESTTEPTTESAAVSGSAAALGSESAAGAGAGAAGAAGGAAGGGGAGAGTDAAAAVHFRALTRVDVAEGETVL
SVPLSLGLSIASFRAVSVAAAELRAGGGVGTPGEDKLGPIKVPVAIPEWAEDFGVMMPVLDLANHAFLGEGANVLYEILP
PSNPGDGWAAVLVAARPIAAGEPLLFDYVAGAEDGPSGLTCTDRWLEEYGFMPHSSDPHRECDTFDISRAEEVEEGSGSH
VRQRWHLMEVCLAILLLGTVAMAKGPVAAPDKPIRVCVLDSPPTVGLKNGVKLNDGQSLTPSAAKDNLQGMGIDMVDVLF
NQILKWNFTIVYYTFAQMGFSRILYDVRVQENCDVAVQSFFISASRDLCTKACPLPDNSTVLQSDSDYEKFACCVDFSQP
FYDGGWTITSKISDGSNVNYFSVFFQRDIVHIIAVAVITTFVIAHVVWLVERWGPGHVWVEEEDAVVDPNSDLASSAFSS
KYLDALRDGVWFSSNVLLNGVIAPEKRIRTPLGRLIITVWVLFGIFLISFVTSIISSTLTTAQLSASQILTANDLAGRTV
CLEEGFYNFFFDSNFPGIGVSKVLVPHLSDCFEELKGGSAEAVFGVRDYSIDYFSQGKGRGLLVSPTIYPQPYGMVWSQS
WEYGSAVNEALLLYREDVYATTPSYRDSKRRWYAGDASQIAYGGTAKQAQKVWNWALVYTAVGLVAVYVCLQVLVYIGGR
FAHDAADDEEDVAATGSGDLRTDSGHSGASLTRAKSVKAALGTFASKMTARQPSTRVTPNHSTGQIATPSFTARQMMLSS
GILLVYLSISPQVTTFSLAMGRDEQKQYLHCDTCGNKVLSYSFIRVWNHRHRRNASSVSGIDLDTFEPPPPDKQLETPAA
PSPPAPEQLTAAPATEDAVAAGLTAVPEPEAAQLRPVLRAVSG