TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8JF47|A8JF47_CHLRE Mitochondrial carrier protein OS=Chlamydomonas reinhardtii GN=MITC1 PE=3 SV=1
MAVPSTSSGMVFAAPPQFGFSQERGNEPFSIKKALKKGSPAVVPMGSAPLTASTCTFTTGGNAVAGRKLASRRAMARSRL
AAAPFASLSLAAVTMTPPPKQASGSVAPKKKKEIGEILSTAGKKALSGGVPGMVAMGIQVLSLMWLRTTINYQYRYGTTT
MEALRTLYSQGGIPRFYQGLLPALIQGPLSRFGDTAANTGMLALLEDVDMPVAMKTVAASLAAGLFRIVLMPVDACKTIM
QVEGKNGFAALVNKVKVGGPTVLYHGALAASVATFVGHYPWFATYNSLNAWLPRYEDDLPKKLLRSAFIGFCSSFVSDCC
SNSIRVIKTAKQTATVPMTYADVVKEVVKKDGVSGLFVRGLGTKIITNGMQGIMFSVMWRLGQDYWNKQAADKAAQEKAD
AEAAEKAAAAASKGKK