TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8JF90|A8JF90_CHLRE Voltage-gated Ca2+ channel, alpha subunit OS=Chlamydomonas reinhardtii GN=CAV2 PE=3 SV=1
MTYPEYSLLFLRKSNFVRKWCVYTTHTRVFEWTILAAIIANCVTLAVSSNRQDFDETPLGRTLVNLEYLWVAIFTTEALL
KIVAMGFVLAPGTYLRDGWNIVDFTVVALGFVDIFSSGNLTALRTVRVLRPLRAITRIRGMRILVTTMIAALPMLIDVFA
LCAFTFFIFGLVAVQLFSGRMTHRCAVPVFDGSYTEVVGGSTFYRNVTYVVQDEESGDGCSGPMSEGLEWVDVNGTAVAL
AGGDGLGRACPDGLYCTNYGNPNYGITSFDHILWAWLTIFQMITQEGWTDIMYFTSDTITWWVWPFFVALVAFGSFYIIN
LALAVLFMQFSNDNHADDPSKKKSGRQGSGDGQRQGDKAGAGGGGAANSGGEHKDSDSESSMSDVGSEEDERLRPTMAEV
TGLRTVGQHSTKLKSATSSPLTMDEVERLSPFRRRLYRVAASRWLELFTMSLIILNTVLMCINWFEMPESVERATNYINY
VFTVYFLVEMILKMTAFGLVRYFRDGMNIFDCLVVVISVTEMVLDIIPSVSGLGPLSVLRAFRLLRIFRLARSWKELNLI
IRAIFKSITSTTYLLLLMLLFMFIASLMGMQLFGYKFMFCDYVEGAAPTCPLGWNVWGQCPDHFHCYLPCMSADYGSWVN
ATGSFYNDLAYCERFCANDQAAAAADANATSPDVAAAGGCEYLAMVGKSEVPRANFDNIFWSMYTVFQILTMENWNNIMY
DGMRSTTPWCAAYFVAVVLIGTYLVFNLFVAILLDNFSSVFGESDDSDGSGSGSLKADGQAAGSGKHKSRRSSSSSSDTD
SLHDSDLDAGEAGDAFGSMRSHCEYAGNEFADSPHADDASRPSSPGGTYYSTEGYHTRFSREYERAHGAGTGRGSGEGGG
AGYTTHEAHAQRATGGPGGGHAPTGASPAPQQGEGEDVAAAGGADGPGAGAGPGIGIGIGGSRRAPPTLHLPDSPSAVGA
LPPIGPAHQPVPSPKTPFSAGIGYAHPSPGAKGGHPVTQSPSDLSRGLRGVLRKVVPVDDEGRPGSSHSGSQPPRPSLRP
VSAAPRPLSSVRGGGGNRVRPVSGRPPVKFDGVDSGREGGGGGGVTFANDAVSRRASFIAAHQTAAAGSQGAGEANGGST
SQGGLAASISRSIGRSIGRSVSRTLQRAMSSIRSIREVRHNEHLAKQIKGRSLLLLDPEHWVRWRAARMVHHTHFETVIL
GLIVLSSITLALDSPGLDPDSQLAQALRYLDYIFLGAFTLEAALKIITFGFAFTGKHAYIRNGWNVLDFIIVLAGYALLA
VELSGANGEDLKMLRILRTLRALRPLRAASRYEGLKLVVNTLFAVLPAMADVALVCALFYIIFSILAVNLFKGQLYNCID
ADSGERLDPYYLLPPGQTLERGMCEAGSITVNSSVYTAARNISLMPYNITTSWVNPVANFDNVAISMLTLFQIATLELWV
DIMFTAVDVAGVGKQPLWNNHPVVILFFILVVIVCCFFVLNLFIGVTLDKFTELQQAQTASSVFVTPQQQNWVDVQKLLL
RTGMTSRPARFEEPAWRAGLYDFVMGSVFEEFILITIVVNVLFMAMVHADMSPQWQACMTYTNLIFTCVFVIEAALKIMA
FGAFAYFRDRWNAFDFFVVVISVASVVLDFSGTQNLSFMPVLRVLRVVRVVRLIRRAVGMRRLLLTLVQSLPALGNVGGV
MVLFFFVYAVIGMNLFGGIKFGDYISRHANFNNFGKAMLLLFRQASMARYYEARFLAVSPGRMITGESWSGVMQDCMITH
NCVLITANVTAPATNATLVEGTYLSPNDPSMSGLPPDVHQNQCSLSPWAAVVYFPTFIVLCGFILLNLVIAIILENMITS
ENDEGLTVSKSLVGQFVDAWSQVDNCATGYVHASKLPLIISHIEPPLGTRGQGNARAVTQAVIMSVDVPIHENNTVTFVE
TLHALAGRVAGTELPEIEEEWLVEKYSKRLPDGGAAFPKLTAAHFHAALYVQAAIRGFMARHKMRGMMQTLAGGPGGAGG
GTGSGSGADADGLHNGGKAFEKGGKVA