TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8JIR6|A8JIR6_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_180784 PE=3 SV=1
MAGGNLFKGLYSSDSLSRPQRLARAAAVGVVVCGGAYAVNRRCRPESVRPKQSEKRFLLPQPVVDAICGAVGEVSQIVLL
YPLETIKVRCQADCLSATAVVQNMTRNGWGPHVVQQLYAGLGSAAAFSVVVGAIHWLTFCTAKRAALDVMEEAPEGADVG
MLASANMVGATVGAIMTALVEGPLELFRHQAQAGLISGNLFREMNNVVKKQGPMGLYWGFLPYCLESFPYDISELATYSQ
LRDVYNQAVTQANALTGGKASALFGPEAKVPSQVRQLQLWDIAIGAAAGSAATLISMPFDVVKTYMQVRAFFATGSRMVA
QHGAGALWVGVVPRLAQQVPSCTICWHAHSNYVRAYVVRRNTQQSHTNA