TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8JNI3|A8JNI3_DROME Debris buster, isoform D OS=Drosophila melanogaster GN=dsb PE=2 SV=1
MGLEKHYLRYGRTARDHLLDWATCGRGRRQQQQQQQQQTHAQPSQGSTATGRRSRPHVTHRGTPLSMLISNGVRISNNRL
AVIIIGIITLILGIILSSMPWLDYFILKNLRLWNDTLSYHYWQRPGVIRLTKLYIYNVTNPDGFLRGEKPHLQEVGPFVY
REDMQKVNVKFHENNYTVSYQHKKILQFVPELSIDKDTPITTPNIPLLTLTSLSPKLGYLLSKTISVVVTAAQFKPFINV
TAEQLAFGYDDALVSLAHRFYPKHMRPMERMGLLLGRNGTLTEVSSVKTGMDSMDQFGYIDQLNGLDHLPHWSEPPCTSI
AGSEGSFFPPRELTKSEVVHIYDKDLCRIIPLKYVESLEKDGIAADLFRLPNNSYGDSAHNPENKCYDTSEYEPIQGLQN
ISPCQYGAPVYISNPHFFESHPDLLNSVEGLKPEREKHETYFKIQPKLGVPLEGKVRIQLNLKVTRAKDVYPVRDFRDFV
FPVMWLEEGISELTPAIKRWIYLGTVIAPSAVPIGSYLMILGGAFAIIFSFVRAYQNFMFAQDPTLEILEMGRRSLRRGS
SFIAHQQHRLLVHHRDSYSLLRHGPMATCLGEGNREEDAQPIIDVSLSGGISQES