TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9UJ61|A9UJ61_TAEMU Coenurosis protective protein (Fragment) OS=Taenia multiceps GN=45m PE=2 SV=1
LLATAVLASDFEQPIERTVTGHQSLRDIFTWGPVFSELIGLNWNRDAFHNAYHEVLTLKAALSSDPSNTKTTYAQLGDGS
ATLKGLTSNATYLVTATVNISGNTILVLSSTIHTLANDTDPIQNCFHWGPVTNQSIQVSWDQLDPEDTHDMIVTLTAEMA
SNPSVERSESARFSQGRVTVDGLMSDTLYIATVTVLKDGRQFFNSTRDIQTLDTGHKEVTVVTTSGSAIVSA