TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9WGA9|A9WGA9_CHLAA Cobalt transport protein OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_0792 PE=3 SV=1
MAFHLDPRAKTLMALLWTVVLSTAASIPVLVIGMMPVLLIVWCSGQQPAFLRWLRLIALMITGWMIIALLTLDWQTALTV
GLRILALSSIFFVFLRTTTPEDLGGAWQQTGAPFPLIFLLTASLQYVQVMEQRIQHIIAAQRARGIPLEPGWRALRYYPA
LLIPLLVQALVSAGHLAAAMEARGFSRAGRSQFLTYHWRLRDWLAIGMTVMAAGFLFWLRL