TCDB is operated by the Saier Lab Bioinformatics Group
>AET84893.1 hypothetical protein MPXG_00095 [Micromonas pusilla virus SP1]
MTPIDKFKLIVIVALLYGFIYSRMDPEEFGFSSPLDPYYFSFTTMSSVGYGDSSPKTDRAKLLVMTQQVFIFGEILKLLM
FKRKSK