TCDB is operated by the Saier Lab Bioinformatics Group
>AEX09227.1 kappa-KTx-like peptide k-KTxpcavC10 [Pandinus cavimanus]
MKSSLVVASLLILLFVSINDYTSVYAQSTHEESGSKMERRARIKRAGCVIKCLQFTPELEKCRKLCGLK