TCDB is operated by the Saier Lab Bioinformatics Group
>AFU60436.1 hypothetical protein Ngar_c35230 [Candidatus Nitrososphaera gargensis Ga9.2]
MYSSDRKKVGFLRKTLPEYMVVKKGLIGLSSYLIPKSLAESVDKKGIRLRITAYEARHKYSHSKMKRLAIYGQVPKSAVQ
QRIVYDRLQTLRYSTTRNRLAAGIAFVSGILFLLSGYRANIEIYNLIRDQLVINTARDFWTYAVIPIGFLALLSQLGGLT
VLMGAGLFAANRVNIGKFLVFVGTGQGLITVLIRIALEFWSGRLALDNNYITWLTSTATGLGILFAVVASYITKGKGESV
YVKAIRFILRKRSVARRPRT