TCDB is operated by the Saier Lab Bioinformatics Group
>AJG42984.1 equilibrative nucleoside transporter 1 isoform X1 [Harp seal herpesvirus]
MKTHYHPQDKYNYVWMVFSLLAMSSVLPWNLFITATSYFTLRLSHNGSLISDITDSNVTALTVLSQVFPNSITFSSMCSI
LLFTYINCLLQKKISKPVRIAGSLLGILGVFLFTAVLVLVPMEAVTFFTVTIITVIITNSFGAILQGSLFTLISAFPPIY
MTAFIIGQGLAGLFTAAAMLITIAVDLEPINSIFTYFLTASGIITIGIFVYLSLPALKFFRFYTTTYTDTLNAQLVFLLH
ESRHAPHKAHHKKCGFKTYLNNKYKSIMIPATSICALYAITIGLFPSVAVDLKPEVNATTSKYFIPVTCFLNYNCFDFIG
RVLTMFIIWPKNNSVLVPVIVLCRLVLVPLILLCNIQPRHNLPVLFFNPVWYALFIALLAFSNGYFTGLCILTGHQKTDY
GYQGKGGVLMTFFMVIGLALGAALSFIFRLLL