TCDB is operated by the Saier Lab Bioinformatics Group
>AKF46139.1 ABC-type antimicrobial peptide transport system, ATPase component [Pseudomonas syringae pv. syringae B301D]
MSRALLELNGVTRRFVAGEKDFIALNDINLTINAGELVAITGASGSGKSTLMNVLGCLDHPNSGSYKVDGRETGTLTDDE
LAELRRDHFGFIFQRYHLLPHLAAIQNVEMPAIYAGTGKGMRVERAQKLLERLGLSGHLEHRPSQLSGGQQQRVSIARAL
MNGGEIILADEPTGALDSVSGKEVMNILLELNSAGHTVILVTHDEKVAAHAERIIEMRDGEIIADRVNTDRPIINEKTTE
RLPTKPRQGNRLMANIGLFQEAFVMAWVALISHRMRTLLTMLGIIIGITSVVSIVAIGEGAKRYVLKDIQAIGSNTIEVF
PGSDFGDTKSMDIQTLALSDVAALSSEYYIDSATPNIGRNLLVRYRNIDVSATVSGVSPSYFQVRGTKMGLGVGFNKDDA
RRQAQVVVIDHNTRIRLFGPKVDPLGQVILVGNLPCTVIGVTENKKNIFDTSKNLNIWMPYETASGRLLGQTYLDGITVR
VKDGQPSKVVEDNVNKLLQKRHGTKDFFTYNLDSVMQTVQKTSQSLALLLSLIAVISLAVGGIGVMNIMLVSVTERTREI
GIRMAVGARQSDIRQQFLVEAVMVCLIGGVIGISLSFVIGYVFSLLVKEWQMVFSLSSIVTAFICSTLIGIVFGFVPARN
AAQLDPIEALARD