TCDB is operated by the Saier Lab Bioinformatics Group
>AKM78652.1 glycosyl transferase family protein [Candidatus Wolfebacteria bacterium GW2011_GWB1_47_1]
MRITKLFTSAQYIILAIILATSFVLMYSASQQESAIMDELAHIPAGYGYVAELDARLNPEHPPLVKIIAALPLTLLELTF
PTDSPAWQDEINGQWVTGAQFLYESGNDADQIIQWSRLGPMLLTILLSLLVFFWSRSLMGSWWALIPTTLTAFSPSILAH
GHYVTTDIGASLGFILAIYYFGRFMMHSTKKNLVYAGIAYGIAQLLKFSAILLIPLFVFLIVVFIFVKAFNHRVSLLAKL
KHFIQYGFQYASYLAGIFVIGYLLVYLVYIPITINYPVEKQVADTTTILTSFGGENGVIPPCEITKPNMRCLAHLDIEMA
KHSITRPFAQYTLGVLMVIQRASGGNTGYFLGEVSNTGWWYYFPVVFFYKEPIPSLILLGFALLLGIWTFLKKFRSPSSL
KERFFTYVNLNFAEFSMLSFIILYWAYSMKSPLNIGIRHVLPTIPLMYILAAGRIKQWTRQEFDFSHGLLRNLFVVIIGI
VKSSFKAAIILFFVVWYIAEAFLAGPYFISYFNEFAGGTASGYQKVTDSNYDWGQDLKRLDTFVEENNIDRIAINYFGGG
SPRYYLGDKAVDWNSTMGNPKQEGIEWFAISVNNLQSAIGNPRAGFERKPEDEYLWLLKEKDPHTPNARAGTSIFIYHLK