TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80418.1 daunorubicin resistance ABC transporter ATPase, antibiotic transport system ATP-binding protein [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MTKKDVVIEVEGLVKSYGDTEVLKGIDLTVERGTMLALLGPNGAGKTTTVRILSTLLGFNAGAVSIEGHDVRSEADDVRS
VIGLTGQSAAVDEMLTGRENLVMMGRLYHLTKESAKARAEELLEDFDLVKAAGRPAKTYSGGMRRRLDLAVSLIATPPVI
FLDEPTTGLDPRSRIAMWDIINKLKQNGATILLTTQYLEEADQLADQIVVIDGGKVIAQGTAKQLKAKIGKDRLELTFAS
DKLFAAAKKALGKKLLDSDDTERTVTALLKDTNVDVRQVLDILAKEDIKFESMAVHKPTLDDVFLSLTGKQTDSSEEKA