TCDB is operated by the Saier Lab Bioinformatics Group
>AKM95170.1 ryanodine receptor [Dialeurodes citri]
MTEADGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLSQCVFVIEQALSVRALQELVT
AAGSEQEQGSIGKGTGSGHRTLLYGNAILLRHHNSEMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSKG
EKVRVGDDLILVSVATERYLHTAKENDLSVVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSNW
TEVPGQNIVIYEGGSVMSQARSLWRLELARTKWAGAFINWYHPMRIRHLTTGRYLSVNENNELHLVGRDEATTATSTFCL
RQEKDDQKVVLEDKDLEVIGAPIIKYGDSTVLVQHSETGLWLTYKAYETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQ
EEESRTARVIRKCSHLFTQFIKGLETLQTNRRQSVFTSSVNLNEMVMCLEDLINYFAQPEEDMEHEEKQNRLRALRNRQD
LFQEEGILNLILEAIDKISVITSQGLMVNLGGDESGQCWDVISGYLYQLLAAIIRGNHTNCAQFANSNRLNWLFSRLGSQ
ASSEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLL
LQTQLVDHVASVRPNIFVGRVEGSAVYQKWYFEVTLDHVEKTTHMTPHLRIGWANTAGYVPYPGGGEKWGGNGVGDDLYS
FGFDGAYLWTGGKTTNVNPEATEPFIKKGDVIGCALDLTIPVVTFSFNGHPVRGHFRDFNVDGMFFPVISASSKLSCRFL
LGGDHGRLKYVPPEEFSPLVESLLPQQILSIDPCFYFGNLNKCTLAGPWPVEDDTAFVPAPVDTSMINLPSYIENIRDRL
AENIHEMWALNKIEAGWQYGELRDDIRKIHPCLVQFDRLPPAEKRYDSQLAVQTLKTILALGYHITMDKPSSRIKTIRLP
NEPFMQSNGYKPAPLDLAAITLNVKMEELVDQLAENTHNLWAKERIQQGWTYGLNEDPDMLRSPHLVPYAEVDDAIKKAN
RDTASETVRTLLVYGYMLDPPTGEANEAALLAEANRIRQMTFRTYRVEKNYAVTSGKWYFEFEVLTTGPMRVGWARVDCG
PGYQLGSDENSWAFDGFNEEKVRCNAAEQFGRQWQVGDIVGACLDLMDRTISFSLNGELLMDALGGETTFSDVQGEAFVP
AFTLGVGQRAKLTFGQDVNLLKFFTVCGLQEGYEPFCVNMNRAVTYWYTKDQPIFENTDDYPSPFDVTRIPAGSDTPPCL
KISHNTFETMEKANWEFLRLSLPIICLPEFIDEAEKMRRWQEIRIRQHRLLAEADKTTPAHIEQIMKSGFSMSDIKGLHR
NYSGDAVEADEMMMNGGGAGPIQSKSKKGPSRPPRKGSLSRNEDLQMDSVMPSGKIHRSSSELDVNRYSTMNGNMGDIKD
DKKKRGRSPFRFFSRKRDQSGERGKKAKTPEPSSLAVDRMEGMGQSRTGHPFRTSQANIKLVPPAIPDRTPTGPKQMSGS
PLTSSGVEAIGNEIYDVECLKMMNEYFYGVRIFPGQDPTHVYIGWVTTQYHLHSGTFNQSHVRQSNITVIDDYGRVVDSI
NRQSCYMLRADELYNEVTNDASGKGASQGMFIGCFIDTATGIMSFTCEGKETSHKYKMEPEAKLFPAIFVEATSKEVLQI
ELGRTSTTLPLSSAILQNSERHVTPQFPPRLKVQCLRPHQWARVPNVSLQVHALKLSDVRGWSMLCEDPVSMLALHIPEE
DRCIDILELIEMEKLLSFHAHTLTLYAALCYQANYRAAHTLCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLDPHA
TTMEACKNEYIIPLGQELKDLYEDAQMGHSLRCLKTESVQPVMKMTNIAETVDNIRNLYSPFFPLDVVRDYVMMALDEAV
QINHVHNRDPVGSNENLFLPLLKLVDRLLLVGILRDEDVEKLLIMFDPETWDSFFERDGKDEHRKGLFHMKMAEGAKLQM
CYLLNHLGDLQLRHRVESIISFSHDFVGEIQSDQLRRYIDIKQSDLPSAVAAKKTKEFRCPPREQMNAVLGFKNLEENDY
ENSPCGDELRQRMNEFHTSVMRHVSLLALQEPTEEEEKKDDIAKPNMFKRLTNFINAVKELEEEPKPPEEPEKKSPEEIF
RKVLISTIVKWAEESQIEMPKLVREMFSLLVRQYDSVGELIRALEKTYIINNKTKGDAAGMWVGLSQIRSLLPVQMSQEE
EGLMRERLWKLVNNHTFFQHPDLIRILRVHENVMAIMINTLGRRAQAQSDAPQAGTGAMEGEPVAKEKDTSHEMVVACCR
FLCYFCRTSRQNQKAMFDHLSFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNS
ELVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLRAIMDANKMSEQIAD
RKKLMDEAEGSTAVMQFEHPLPESDEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIAQGKNESLRARAILRSLVPLED
LLGVLSLRFTLQNPAAGEERPKSDMPSGLIPGHKQSVVLFLERVYGIEQQDLFFKILEEAFLPDLRAATMLDRNDGLESE
MALAMNRYIGNSILPLLISHSRFYNESDNYANLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPSMLLKLLRK
LTVDVSTLSEYTTVALRLLTLHYDRCAKYYGSTGGQGLYGASSEEEKRLTMMLFSNIFDSLSKMDYDPELFGKAPPCLIA
IGCALPPDYSLSKNYDDEWYGSKTQVQTGPADGPYNPQPINTSSVQLNNDLNTIVQKFSEHYHDAWASRKLENGWVYGEQ
YSESQKAHPRLKPYAMLNDYEEKERYKEPVRESLKALLAIGWSVEHTEVDVPITNRNSVRRQSKATLDTATPFNYRPNPI
DMTNLTLSREVQNMAERLAENAHDIWAKKKKEESVTCGGGIHPQLVPYDLLTDKEKRKDRERSQEFLKYLQYQGYKLHRP
SRGTATSEAEQLAAVQTGELRFAYSLLEKLIQYMDKASINMKLLKPSATFSRRSSFKTCTRDIKFFSKVVLPLVEKYFSS
HRNYFIVVATASNNVGAASLKEKEMVASLFCKLASLLRSRLAAFGADVRITVRCLQTLVKGIDARSLVKNCPEFIRTSML
TFFNNTADDLGHTIINLQEGKYSHLRGTHLKTSTSLFYVNDVILPVLTAMFDHLAACEYGSDLLLDEIQVASYKILQSLF
TLGIDSSLTHDRKYLKTEIERHRPALGTCLGAFSSTFPVAFLEPHLNKHNQFSLLNRIADHSLEAQDIMARMESSMPTLE
TILGEVDQFVESGKSHGDAPHVIDVILPLLCSYLPVWWAQGPDNVNLTADNHVTMVTSEHMNQLLKNVLNMIKKNIGNDN
APWMTRIAAYTQQIIINSSEELLKDPFLPLAERVKRRTDNLFHKEESLRGFIKSATDDTSQVETQIQEDWSLVVRDIYAF
YPLLIKYVDLQRNHWLRNNIPEAEDLYNHISEIFNIWSKSQYFLREEQNFISANEIDNMILIMPTATRRSASAVTEGTAS
GGRGKKKKKHRDKKRDMDKELQASLMVACLKRLLPVGLNLFAGREQELVQHCEDRFLKKLPEYEIMDFVKPQLTLPDKID
PADEMSWQRYLYSKLGSKKDSGEVAKPQQIDEVVDRIVAMAKVLFGLHMIDHPQLQSKAVYRSVVSTQRKRAVIACFRQL
SLHALPRHRAVNIFGRTYRELWLQDENVGQEVMIEDLTQSFEEAELKKADKEEDEGKPDPLTQLVTTFCRGAMTERSGAL
QEDPLYMSYAEIIAKSCGEEEEEGGEEEGEEAPEGEEGGSGSIHEQEMEKQRLLFNQSRLADRGVAEMVLLHISACKGVP
SEMVMKTLNLGIAVLRGGNSDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGLEGAAGEKNMH
DAEFTCTLFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDPAGKANFFKAIG
VASQVFNTLSEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVV
NGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTSSASFLEIDPNNEGWVLPKDFKEKMEQQKSYTPEEIEFMLACCE
TNHDGKIDYVGFTDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGGSKRIERVYFE
IKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVDDGSGVGGGKTRKAAYSYLTDD
DEEKNVHPVKRGLQAVKDTIFFIFAMLSPSNIKHKMGELQQMSAPEMVVGFFKLFFYLFYYSGFSVMVVFRYFARILMTL
MRGPQVEEPVVEVKEEEKWGSMKKLPALPSPEDSKDSQTEGSKEDGGHDKASHEGTPSGRQLSTDEGGDSPTGESGDSHS
RSDSDEAAKAEGALTLTEFLGLDHSSEDSGGAAKKEAALVAEVAAQHQAVMAAVEAEGKQETVAEPSAFSQIDFNGYTHR
ALSFLARNFYNLKYVALVLAFCINFILLFYKVTVIGGDEEDGGSGDDFGGISGEDLLGMDGGSGDDGGGSGEDEEEPLEI
VHVDEDFFYMYHVLRIAAFVHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPSDDDIKSHWDKLVISAK
SFPVNYWDKFAKKKVRQKYSETYDFDSISNLLGMEKTSFSSQENEEGSGVINFILNIDWRYQMWKAGVTITDNAFLYSLW
YFTFSILGNFNNFFFAAHLIDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIVVYLYTVIAFNFFRKFYVTEEDDNVDMK
CHNMLTCFVFHLYKGVRAGGGIGDEIEPPDGDDYEVYRIMFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKEDME
SNCFICGIGKDYFDKVPHGFDTHVQQEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFPVGDCFRKQYEEE
LGGGGG