TCDB is operated by the Saier Lab Bioinformatics Group
>ALM14528.1 Ion transport 2 domain protein [Candidatus Peribacter riflensis]
MEMQHGSPNNGRPRLHQRLAEKIITLPYTALFSLWFVLAALFAAAYALLAVFAPEHAPQALLDQGPLRLIGNSLYYSVIT
STTTGYGDIVPMGFSKFLSCIQSVVGFFLLAVFVTKLVSQQQELAVRQMHKLTYEDVFHNTREGLFVIRNDFDRLIQKVE
QREPLTLEDWDDLAIAFKQGQSLLLEIPEFYSPEEVGLYTIDERREQLLQEAVHRTLHRINQLIDGFGLAGIDWTAHQKS
AQELKEFLSVVGRVAPLWHARSPYAKNESFEMILRLKERAMNRMKHAA