TCDB is operated by the Saier Lab Bioinformatics Group
>ALR88526.1 major surface protein [Treponema vincentii]
MKKYLLVSLTILFAAAFVWAADATTVEPSVDIEAEATLSWGVNVEGNTVKHGFKNEASWTVKFPLLKKADRTSTKSDVPV
YGQVSLKDVELNVVSEKDSSGRFALDGKVDDLEAKLVVYGAYLTVYNVPDFFKNYAQIWKPIDNDKKYRVADHRFRGAFD
GYGTKIGYANKDFMDLDVGLKLGSSSNWDPNSASHTQTMKYFDGNTALGNSEAIYIGDVSTGTGTWVTGKQVRFPDAGWY
YFVKKNSADPTTYQYAIGFDLSMKPLDKMLGLAFTVNTTLSKNYPDANLNFGVEATSEPMDGLKLKAGFDGMYDFNAASN
AFNWDTVFTAQYKWVGAGVYVASADTWMGSNKAPYANRTDMAVFAQFATKGDKGDATNLVEGLDAGAYISMYKLLYGLSD
IKKFPLLVKVWGAYKVNLNDAMWVKPFADVWVESDAKHGNSIGLAYDLGVKFSPVEKVEVKAAWEHGSINKNAYSSATQR
KYKKDYVSVVDHSVLDSTFYGQFVLSLTLTY