TCDB is operated by the Saier Lab Bioinformatics Group
>AQT84710.1 sporulation killing factor system integral membrane protein [Paenibacillus larvae subsp. pulvifaciens]
MNNIISLQLLHTYRTFIDVTTSKSRLWTPLLLFFALMGLHIYIGTGDGPANASISGWIIVVIYIVYGLFGLISTRMPSRM
EDVLWIYSVPLPFYKIIYACFIPKVIVRAVFWIGSAIVADIGLLFINQGSYHLAMSSMSSFLILVTLEFCCLAASSLRGN
KMYTLWAGLILAVLLIFHMGITYLFIFRENSVYIDPVQPIGLLLTGTFSLAGVLFIGAIAALSLLLIYVSSLKLKNKEKL
VAEASFWSEFKDFHSLVSSIRGKDRPSWWGAGG