TCDB is operated by the Saier Lab Bioinformatics Group
>ART98386.1 PTS beta-glucoside transporter subunit EIIBCA [Lactobacillus gasseri]
MDHKKVAETVIEAVGRDNLVAAAHCATRLRLVLKDDSKVNMKMLDSDPDIKGTFKTNGQFQIIIGPGDVNNVYDELIKMT
GLSELSTDDLKKVAQKDQKFNPVMAFIKLLSDIFVPIIPALVAGGLLMALNNFLTSPGLFGAKSVVQMAPNVKGLSEIIQ
VMSAAPFIFMPILVGMSAAKRFGANQFLGATIGMIMTTPALGGAGKYWDIFGLHVSQTNYQYQVIPVLVAVWLLAFLEKR
FHKWLPSAVDFTFTPLLSIMITGFLTFTIIGPVFKGVSDAITAAIVWLYNTTGAFGMGIFGLSYSAIVTTGLHQSFPAVE
TQLLAEYARGRGSGDFIFVTACMANVAQGAATFAVYFLTKNEKVKGLASSSGVSALLGITEPALFGVNLKYKFPFFCALI
GAGVGAAFAGLMHVTAAALGSAGFLGFLSMVPKSIPMWALSVAISFIVAFALTFVYGKRHFKEDVVEESGTVESAGDQVA
QQEKADQIIKEDKELHDEVIAAPVSGKAESLKDVKDPVFSTEAMGKGAAMVPSEGTIYSPVTGEITVAYETKHAYGIKSD
EGAEVLIHIGIDTVNMKGEGFTSDVKQGQHVEKGEKLGTVDLDAVNKAGYDTTVMTVITNTASYANVQRIDGVDKKHGDD
LIAVTKR