TCDB is operated by the Saier Lab Bioinformatics Group
>AVM72784.1 magnetosome mebrane specific protein 5 [Magnetospirillum gryphiswaldense MSR-1]
MAAQMATGMAGGTAANAAAPAAGGAAMAAAAAPEIEREGAAQAAGMKAGGAKAGAANGAATKTGAAKAAAAEVEREAVTA
KAAGMKAAGAKTAAGGANQAAMAAKGAGMVGSTVGGATKVAATGVKGKAMVAAGGTGAAGAAAGAATGASVTASPIAAAT
SSSAMLSAKGVSLGLGLGLGAWGPVLLGVVGVAGALALYGYYKNRNAEPAAAEAV