TCDB is operated by the Saier Lab Bioinformatics Group
>B0K2P3|B0K2P3_THEPX Putative uncharacterized protein - Thermoanaerobacter sp. (strain X514).
MTEIKALLTLDLLRFKNFVKDIIKNPKRIFIYLLQFIWFVFILIPVITKRGKTFNEISTIKFEVFNAVLIAVMLLGVFAS
LFTSLRQPGIILSPGDTAFLLSSPIRERMIFFWYMVRSIFKNLFIAVLFIIYLPFLSVTMEIFKYSQNLIWGYLGVFTFY
LALSPLSFLFYSISMKFNAKEIIKYILWSVLVLVLGSAVYFAYKEQNIYGFIEYFDLKGWDYVPIIGPSKGLILSYFTGN
SHNAIIQIILQFVTIVLLVFIGLYFATDYYEEVVTYNEKIRKIREKADKGDLSGTEENVKKKKRKVEVKFSPKGPWAFIW
LKMVENKRQIGSIYFNFYNLFLLVISIAFGYFLPKNDSTIIFVLAFMYAYMAWLLSMVSTIGAELNRMYIYIIPGEGIEK
LIAVNFVPLLKSFITAILLIVPASIFIKPGLLNTIAAILFIISLSVLQNFSYAFLLTFMPSKEDIKIAIPFFRLFGLLFV
LIPVGLVSIPLGIATKSMGIGILSASIIMLLEAGMFLLFANYIFERLELK