TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B0T2Y9|B0T2Y9_CAUSK Cytochrome c biogenesis protein transmembrane region OS=Caulobacter sp. (strain K31) GN=Caul_4691 PE=4 SV=1
MSSTRIRRVRNPFMSLRKLLSALPALVVALLLGAPAFTGMAWAEPVHTGHIDVELISQEAGAAPGSTVFVALRQKIQPGW
HTYWRNPGDAGDATRIAWTLPPGWAAGDIVWPTPEKSRVGPLLDFAYTGEVLLPVPISVPANAQVGSVVTLKAAAAFLVC
EQVCVPEDAVVTLTLPVVAGMPQADPKWGAKVADTLAKAPKPAGLKAVFNLQGSVLKLAVTGAPLKGADVAGAFFYPYSG
KVIEHPPEQAIERGPEGLTLSLTPGYDFTQAEAKPTELAGVLALNGAAYEITATPGAIPAGAGGLGAPAAAKTLSQPVAS
LGLPLAVVFAFIGGLILNLMPCVFPILSMKAASLTAHAHDAGKTRVQGLAFLAGVVVTFLVLAGLLIAVRAGGAAVGWGF
QLQSPAVVAALALLMLLVALNMSGVFEVGASVQGVASGAGGGGGLGGSFLTGALAVVVAAPCTAPFMAGALGYALTQPPL
ASLLVFLGLALGFAAPFVLLAFIPGLLARLPRPGPWMDVLKKGLAFPMYATAAWLAWVYGQQTGSIPLGALLAASVLVAF
AAWLYGLGQARSIMGKSVGVPFVLAGLAGLAAIALVVVGVRAVPATSAPSVMASAEAPAGPGLAAEPWSPERVKALQAEG
KVVMVDFTADWCVTCKVNEGTALKGQRLVDAFQASDAVLLRADWTKRDATIAAALSEHGRAGVPLYLVYPKGGGEPVILP
QLLTEGLVIEAIEKAAKG