TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1VVI2|B1VVI2_STRGG Putative integral membrane protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_1337 PE=4 SV=1
MISVLFAVLTALSNGSASVLQRRAAMEVPDSEAMRLSLMTRLVRQKVWLAGIGLVIVAAVCQAVALATGPIAVVQPIFVI
ELPLTLLVAGLVMRVRADAAVWSGVSAVTAGLALGMASAAPVGGSDMVRGAAWIPALVLTGLFEAGLIGAALRTRGNPRA
ALLGLAAACGYALTAALMKDAMANLDDGGVVALLASWQLYATAAAGVGALFLLQNALQAGSLVAVQPMLTLGDALISILY
GVTLFGEELRTGWWLLPELAALVLIAAGCVRLARTPLAAGTLAPPPAPSAPR