TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1XBH4|B1XBH4_ECODH Lysis S family protein OS=Escherichia coli (strain K12 / DH10B) GN=18 PE=4 SV=1
MYRMDKLTTGAAYGASAGSILNGMLNAYSPEQWNAIGVLVGIIIAVMTYLTNLYFKIREDNRRSRSRDEPNVEE