TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1ZTY2|B1ZTY2_OPITP Uncharacterized protein OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=Oter_2582 PE=4 SV=1
MQRFRSSLILATLLAPAALLAQTVTTSGTVSVSAGGTLLEGNRAAYQRTVQHAKQGFAGIEDFNLTREAEDSVFKFDARL
LPGDEDYRVSFRFDKTDRFYIEGGYEQFRVWYNGGGGYFRPRGMAFTLFDEDLSLDRTRAWLEAGVYLPNQILLRARYEH
RARNGTKDSTMWGDSNAPAPYGTRNITPSLMDLNETTNTFSVDIGNTTQEDQKWNVGGRVSETKIDDKRYSRRRPFDSGG
DRIITTKDESSNDLYAAHGFYLRKVNDQLTVSGGALITKLDTVIEGSRIYGQSYDPVYDPNYARRQQRDEGFYNLEGKAD
VKQTVLNLNAVYTPRKDWSIRPSIRFENRRDEATDEFVEINTGPAPAVAPILEALEGENDKDWSEFTEEIEVRYTGKPNW
TFNGTAEWLQGTGNLEEMLGEAGVFAINRDVDLDRFVQKYSFGANWYAKPGLTFAAQYYYKGSMADYGLTRDNTPPYGGD
RYPSYIIDQDFETHDVNVRVTWRPVTQLNLVTRYDHQESKVTNVMAGLGKSPSGDYSSDIISQNVTWSPTARLFVTGSVN
ARYDQLATPAYPFVQNGDNNSINGSLGAGYVVSQKDDVFVDYHWFDADNYIDNSRTSLPFGLTDTQNAFYVTWVRRQTEQ
MIYTVKYGYVTNDDYTYGRRNDFEAHVLYAKVQYRF