TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2FLY3|B2FLY3_STRMK Putative multidrug efflux protein, HlyD family OS=Stenotrophomonas maltophilia (strain K279a) GN=smeV PE=4 SV=1
MVGVSILAAAVLAACSGGHAEEAGAPPPPQVSAAPVLVKQVSQWDEFSGRVEAVQSVELRPRVSGYIDKVNYVEGQEVKK
GEVLFTIDARSYQAEYDRAAAELARARTQATLARSESERAKRLSEQQAISTETAEQRRAAADQSGAAVQAAQAALDAARL
NLEFTKVRAPIDGRAGRAMVTAGNLVTAGDSASVLTTLVSLDTVFVYFDADESTFLRYAQMARKGERPSERDSELPVKVG
LSGEEGYPHSGKVDFLDNQVARSTGTIRVRALLDNADRQFTPGLFARVQLLGSGQFQALLIDDKAVLTDQDRKYVYVVDK
DGKAQRRDIQLGRTADGLRIVEHGLAAGDKVIIDGVQKVFMPGMPVQAKAVAMQPQPAPAPGRDATAALKH