TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2FLY4|B2FLY4_STRMK Putative drug resistance membrane fusion protein OS=Stenotrophomonas maltophilia (strain K279a) GN=smeW PE=4 SV=1
MDFSRFFIDRPIFAAVLSIVIFAAGLITIPILPISEYPEVVPPSVVVRTVYPGANPKVIAETVATPLEEAINGVEGMMYL
KSVAGSDGVLQMTVTFRPGTDPDAAAVKVQNRVAQAQARLPEDVRRQGVTTQKQSPTFLMVVHLTSPQGKYDTLYLRNYA
RLHVKDALARIPGVGDAQIFGGGDYAMRAWLDPDKVASRGLTASDVVRAMREQNVQVSAGQLGAEPLPDSKFLTLINAQG
RLKTEKEFGDIVLKSGTDGEIVRLSDVARLELGAGDYTLRSQLDGKNAVGIGIFQSPGANALEIRDQVISTMDEMQKTMP
ADVKYEAVYDTTIFVRDSIKAVVSTLLEAIALVVLVVILFLQTWRASIIPLIAVPVSVVGTFAALYLLGFSINTLSLFGL
VLAIGIVVDDAIVVVENVERNIEEGLSPTAAAHQAMREVSGPIVAIALVLCAVFVPMAFLSGVTGQFYKQFAVTIAISTV
ISAINSLTLSPALAARLLKAHGAPKDGPSRLIDRLFGWVFRPFNRFFKSSSEKYERGVARILGRRGAVFVVYAILLVGTG
VIFKLVPPGFIPTQDKLYLIAGVKLPEGSSIARTDEMLRKVAKIAQETDGVAHTISFPGLNALQFTNTPNTGVAFIPLKP
FAERHGRTAAQINAEINQKIAGLQEGFAFAMMPPPILGLGNGNGYQMFIEDRGNLGYGALQNAVQAMQGTVAQTPGMAFP
ISSYQANVPQLDAEVDRVKAKAQGVQLTELFDTLQTYLGSAYVNDFNQFGRTWQVIAQADGPFRETVEDIGKLRTRNDRG
EMVPIGSMVTIKQTFGPDPVLRFNGYPAADLAGEADPRLLSSAEAMTKLTEIAGKVLPVGMTTEWTDLSYQQATQGKAAF
IVFPVAIMLAFLVLAALYESWSLPLAVILIVPMTLLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELEM
GGKGIVEAALEACRLRLRPIVMTSIAFIAGTVPLVLSHGAGAEVRSVTGITVFAGMLGVTLFGLFLTPVFYVALRKFVTR
NGGGQLVQHGEPTIHH