TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2FLY6|B2FLY6_STRMK Putative outer membrane efflux protein OS=Stenotrophomonas maltophilia (strain K279a) GN=smeX PE=4 SV=1
MIRTLAMAVSSLVLAGCVSVGPNYKAPVQEPVVLQGAQQPVFSTTSPVASWWAQFDDPVLEELVHGALSDNLDLRVAVAR
VSQARAVFVESRFDQAPHITAGGSYDRRKQPDPQLGGQRVFSESYQLGFDAGWELDLFGRKRRAAEAARADLDAEQANLA
DAQVLVAAEVARNYFELRGTQKRIAVAQHTLVNLRDTQKLTEARWELGAGSELDVQSSRARLKAIEADIPLLEVAETQSR
NRLAVLLGQRPETLTAMLAPHDVPAFAKALPLGDTRELLRQRADVRVAERRLAAATARVGVATADLFPRLSLSGFVGFLG
GEASGLVNGNNKAWSLTPSLSWAAFDFGTVRARLRASKAEAEGVAAQYEQAVLLALEDTENALTRYSKQQARLAIVVEQA
QAARRAESLAQIRYREGSEDFLTLLDAQRTQLAADDALAAAESEVNVSVVGVYKALGGWGQSPQPPSVAQVQ